Lineage for d5hgna2 (5hgn A:148-219)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706557Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2706558Protein automated matches [191156] (12 species)
    not a true protein
  7. 2706577Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (33 PDB entries)
  8. 2706585Domain d5hgna2: 5hgn A:148-219 [321123]
    Other proteins in same PDB: d5hgna1
    automated match to d2m8pa2

Details for d5hgna2

PDB Entry: 5hgn (more details), 1.9 Å

PDB Description: hexameric hiv-1 ca, apo form
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d5hgna2:

Sequence, based on SEQRES records: (download)

>d5hgna2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

Sequence, based on observed residues (ATOM records): (download)

>d5hgna2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqtllvqnanpdcktilkalgpgatleemmtac
q

SCOPe Domain Coordinates for d5hgna2:

Click to download the PDB-style file with coordinates for d5hgna2.
(The format of our PDB-style files is described here.)

Timeline for d5hgna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hgna1