Lineage for d5hdwa1 (5hdw A:278-405)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.23: ApaG-like [110069] (2 families) 
Family b.1.23.0: automated matches [314680] (1 protein)
not a true familyProtein automated matches [314681] (1 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [314682] (1 PDB entry) 
Domain d5hdwa1: 5hdw A:278-405 [314683]
Other proteins in same PDB: d5hdwa2
automated match to d1xq4b_
Details for d5hdwa1
PDB Entry: 5hdw (more details), 2 Å
PDB Description: apag domain of fbxo3
PDB Compounds: (A:) F-box only protein 3SCOPe Domain Sequences for d5hdwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hdwa1 b.1.23.0 (A:278-405) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vattgditvsvstsflpelssvhpphyfftyririemskdalpekacqldsrywritnak
gdveevqgpgvvgefpiispgrvyeytscttfsttsgymegyytfhflyfkdkifnvaip
rfhmacpt
SCOPe Domain Coordinates for d5hdwa1:
Click to download the PDB-style file with coordinates for d5hdwa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5hdwa1:
- d5hdwa1 first appeared in SCOPe 2.06
- d5hdwa1 appears in SCOPe 2.07
View in 3D
