Lineage for d5ha4a1 (5ha4 A:1-132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939535Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2939536Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2939665Family d.21.1.0: automated matches [191386] (1 protein)
    not a true family
  6. 2939666Protein automated matches [190491] (18 species)
    not a true protein
  7. 2939667Species Acinetobacter baumannii [TaxId:557600] [314639] (1 PDB entry)
  8. 2939668Domain d5ha4a1: 5ha4 A:1-132 [314678]
    Other proteins in same PDB: d5ha4b3
    automated match to d4ijza1
    complexed with cl, mrd

Details for d5ha4a1

PDB Entry: 5ha4 (more details), 1.85 Å

PDB Description: structure of a diaminopimelate epimerase from acinetobacter baumannii
PDB Compounds: (A:) Diaminopimelate epimerase

SCOPe Domain Sequences for d5ha4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ha4a1 d.21.1.0 (A:1-132) automated matches {Acinetobacter baumannii [TaxId: 557600]}
mlleftkmhglgndfmvvdlisqrayldtatiqrladrhfgvgfdqlliveppdvpeadf
kyrifnadgseveqcgngvrcfarfvherhltnktnitvqtkagivkpelgqngwvrvnm
gypkflpneipf

SCOPe Domain Coordinates for d5ha4a1:

Click to download the PDB-style file with coordinates for d5ha4a1.
(The format of our PDB-style files is described here.)

Timeline for d5ha4a1:

2939668
d5ha4a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5ha4a2