Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.0: automated matches [191386] (1 protein) not a true family |
Protein automated matches [190491] (18 species) not a true protein |
Species Acinetobacter baumannii [TaxId:557600] [314639] (1 PDB entry) |
Domain d5ha4a1: 5ha4 A:1-132 [314678] Other proteins in same PDB: d5ha4b3 automated match to d4ijza1 complexed with cl, mrd |
PDB Entry: 5ha4 (more details), 1.85 Å
SCOPe Domain Sequences for d5ha4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ha4a1 d.21.1.0 (A:1-132) automated matches {Acinetobacter baumannii [TaxId: 557600]} mlleftkmhglgndfmvvdlisqrayldtatiqrladrhfgvgfdqlliveppdvpeadf kyrifnadgseveqcgngvrcfarfvherhltnktnitvqtkagivkpelgqngwvrvnm gypkflpneipf
Timeline for d5ha4a1: