Lineage for d5gs1b_ (5gs1 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355178Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)
  8. 2355403Domain d5gs1b_: 5gs1 B: [323961]
    Other proteins in same PDB: d5gs1a_, d5gs1c1, d5gs1c2, d5gs1d1, d5gs1d2, d5gs1e1, d5gs1e2, d5gs1f1, d5gs1f2, d5gs1g1, d5gs1h1, d5gs1i1, d5gs1i2, d5gs1j1, d5gs1j2, d5gs1k1, d5gs1k2, d5gs1l1, d5gs1l2, d5gs1m_, d5gs1o_, d5gs1q_
    automated match to d1t2ja_

Details for d5gs1b_

PDB Entry: 5gs1 (more details), 2 Å

PDB Description: crystal structure of homo-specific diabody
PDB Compounds: (B:) heavy chain

SCOPe Domain Sequences for d5gs1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gs1b_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyya
dsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvss

SCOPe Domain Coordinates for d5gs1b_:

Click to download the PDB-style file with coordinates for d5gs1b_.
(The format of our PDB-style files is described here.)

Timeline for d5gs1b_: