Lineage for d5g5ea2 (5g5e A:85-221)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domainFamily a.45.1.0: automated matches [227130] (1 protein)
not a true familyProtein automated matches [226831] (73 species)
not a true protein
Species Mangifera indica [TaxId:29780] [329180] (3 PDB entries) 
Domain d5g5ea2: 5g5e A:85-221 [329183]
Other proteins in same PDB: d5g5ea1
automated match to d5agya2
complexed with act, peg
Details for d5g5ea2
PDB Entry: 5g5e (more details), 1.8 Å
PDB Description: crystallographic structure of the tau class glutathione s-transferase migstu from mango mangifera indica l.
PDB Compounds: (A:) tau class glutathione s-transferaseSCOPe Domain Sequences for d5g5ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g5ea2 a.45.1.0 (A:85-221) automated matches {Mangifera indica [TaxId: 29780]}
ilpsdpydraiarfwaayldekwypslkgiasaqgeeakkaavdqvgeslaliedtyvkl
skgkpffggekigyldiafgcflgwlrvtektsgvkflneaktphlakwavrfcadpavk
dvmpeteklaefaklla
SCOPe Domain Coordinates for d5g5ea2:
Click to download the PDB-style file with coordinates for d5g5ea2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5g5ea2:
- d5g5ea2 first appeared in SCOPe 2.06
- d5g5ea2 appears in SCOPe 2.07
View in 3D
