SCOPe 2.08: Domain d5g5aa2: 5g5a A:84-220

Lineage for d5g5aa2 (5g5a A:84-220)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.0: automated matches [227130] (1 protein)
not a true family
Protein automated matches [226831] (73 species)
not a true protein
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [324612] (22 PDB entries)
Domain d5g5aa2: 5g5a A:84-220 [335079]
Other proteins in same PDB: d5g5aa1, d5g5ab1, d5g5ac1, d5g5ad1
automated match to d5agya2
complexed with gsh

Details for d5g5aa2

PDB Entry: 5g5a (more details), 1.95 Å

PDB Description: glutathione transferase u25 from arabidopsis thaliana in complex with glutathione disulfide

PDB Compounds: (A:) glutathione s-transferase u25

SCOPe Domain Sequences for d5g5aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5aa2 a.45.1.0 (A:84-220) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
llpsdpyqraqakfwgdfidkkvyasarliwgakgeeheagkkefieilktleselgdkt
yfggetfgyvdialigfyswfeayekfgsfsieaecpkliawgkrcveresvakslpdse
kiikfvpelrkklgiei

SCOPe Domain Coordinates for d5g5aa2:

Click to download the PDB-style file with coordinates for d5g5aa2.
(The format of our PDB-style files is described here.)

Timeline for d5g5aa2: