Lineage for d5fuwa2 (5fuw A:339-384)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. Protein automated matches [190463] (9 species)
    not a true protein
  7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [319948] (4 PDB entries)
  8. Domain d5fuwa2: 5fuw A:339-384 [320084]
    Other proteins in same PDB: d5fuwa1, d5fuwb1
    automated match to d1xbta2
    complexed with po4, qbt, thm, zn

Details for d5fuwa2

PDB Entry: 5fuw (more details), 2.2 Å

PDB Description: catalytic domain of thymidine kinase from trypanosoma brucei with dtmp or dthd
PDB Compounds: (A:) thymdine kinase

SCOPe Domain Sequences for d5fuwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fuwa2 g.39.1.0 (A:339-384) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
avcmechnrkasftyrtvksderklvggsdmymsvcrscyetkrnm

SCOPe Domain Coordinates for d5fuwa2 are not available.

Timeline for d5fuwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fuwa1
View in 3D
Domains from other chains:
(mouse over for more information)
d5fuwb1, d5fuwb2