Lineage for d5fqdc_ (5fqd C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein automated matches [190091] (20 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188447] (844 PDB entries)
  8. Domain d5fqdc_: 5fqd C: [315388]
    automated match to d4hoka_
    complexed with lvy, zn

Details for d5fqdc_

PDB Entry: 5fqd (more details), 2.4499999999999997 Å

PDB Description: structural basis of lenalidomide induced ck1a degradation by the crl4crbn ubiquitin ligase
PDB Compounds: (C:) casein kinase I isoform alpha

SCOPe Domain Sequences for d5fqdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fqdc_ d.144.1.7 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efivggkyklvrkigsgsfgdiylainitngeevavklesqkarhpqllyesklykilqg
gvgiphirwygqekdynvlvmdllgpsledlfnfcsrrftmktvlmladqmisrieyvht
knfihrdikpdnflmgigrhcnklflidfglakkyrdnrtrqhipyredknltgtaryas
inahlgieqsrrddmeslgyvlmyfnrtslpwqglkaatkkqkyekisekkmstpvevlc
kgfpaefamylnycrglrfeeapdymylrqlfrilfrtlnhqydytfdwtmlkq

SCOPe Domain Coordinates for d5fqdc_ are not available.

Timeline for d5fqdc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5fqdf_