Lineage for d5fkta1 (5fkt A:35-448)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2075644Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2076324Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families) (S)
    duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378)
  5. 2076338Family b.69.13.0: automated matches [227242] (1 protein)
    not a true family
  6. 2076339Protein automated matches [227008] (5 species)
    not a true protein
  7. 2076343Species Cellvibrio japonicus [TaxId:498211] [278979] (4 PDB entries)
  8. 2076344Domain d5fkta1: 5fkt A:35-448 [278984]
    Other proteins in same PDB: d5fktb3
    automated match to d3a0fa1
    complexed with br, edo, k

Details for d5fkta1

PDB Entry: 5fkt (more details), 1.52 Å

PDB Description: unraveling the first step of xyloglucan degradation by the soil saprophyte cellvibrio japonicus through the functional and structural characterization of a potent gh74 endo-xyloglucanase
PDB Compounds: (A:) endo-1,4-beta-glucanase/xyloglucanase, gly74a

SCOPe Domain Sequences for d5fkta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fkta1 b.69.13.0 (A:35-448) automated matches {Cellvibrio japonicus [TaxId: 498211]}
psenytwknvridgggfvpgiifnqkeadliyartdiggayrwnsatsswiplldwvgwd
nwgwngvmslatdaadpnrvyaavgmytntwdpnngailrstdrgntwqatplpfkvggn
mpgrgmgerlaidpnrnsiiyygaeggnglwrstdygatwakvssftnggnyaqdpndpn
dylnkiqgvvwvtfdpasgsagntsqviyvgvadtqnaiyrstdggttwsrlagqptgfl
phkgvydavngvlyiaysdtggpydgakgdvwkftassgtwtnispipssssdlyfgysg
ltidrknpntlmvasqiawwpdavffrstnggaswtriwdwtsypsrsfrytmditevpw
lnfgnsnpvapevspklgwmnesveidphnsnrlmygtgatiyatenltswdsg

SCOPe Domain Coordinates for d5fkta1:

Click to download the PDB-style file with coordinates for d5fkta1.
(The format of our PDB-style files is described here.)

Timeline for d5fkta1:

2076344
d5fkta1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5fkta2