Lineage for d5f51a_ (5f51 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2115525Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2116045Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2116046Protein automated matches [190158] (24 species)
    not a true protein
  7. 2116053Species Brucella abortus [TaxId:359391] [313909] (2 PDB entries)
  8. 2116056Domain d5f51a_: 5f51 A: [313910]
    automated match to d2rg1b_
    complexed with so4

Details for d5f51a_

PDB Entry: 5f51 (more details)

PDB Description: structure of b. abortus wrba-related protein a (apo)
PDB Compounds: (A:) NAD(P)H dehydrogenase (quinone)

SCOPe Domain Sequences for d5f51a_:

Sequence, based on SEQRES records: (download)

>d5f51a_ c.23.5.0 (A:) automated matches {Brucella abortus [TaxId: 359391]}
mvkmlvlyysaygymeqmakaaaegareggaevtlkrvpelvpeevakashykidqevpi
atpgeladydaiiigtatrygmmasqmknfldqtgglwakgalinkvgsvmvstatqhgg
aelalistqwqmqhhgmiivplsyayreqmgndvvrggapygmtttadgdgsrqpsaqel
dgarfqgrrvaeitaklh

Sequence, based on observed residues (ATOM records): (download)

>d5f51a_ c.23.5.0 (A:) automated matches {Brucella abortus [TaxId: 359391]}
mvkmlvlyysaygymeqmakaaaegareggaevtlkrvpelvpeevakashykidqevpi
atpgeladydaiiigtatrygmmasqmknfldqtgglwakgalinkvgsvmvstgaelal
istqwqmqhhgmiivplsyrqpsaqeldgarfqgrrvaeitaklh

SCOPe Domain Coordinates for d5f51a_:

Click to download the PDB-style file with coordinates for d5f51a_.
(The format of our PDB-style files is described here.)

Timeline for d5f51a_: