Lineage for d5elna2 (5eln A:194-545)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2968016Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2968017Protein automated matches [226887] (24 species)
    not a true protein
  7. 2968043Species Cryptosporidium parvum [TaxId:353152] [326196] (5 PDB entries)
  8. 2968048Domain d5elna2: 5eln A:194-545 [326244]
    Other proteins in same PDB: d5elna1, d5elna3, d5elnb1, d5elnb3, d5elnc1, d5elnc3, d5elnd1, d5elnd3
    automated match to d3bjuc2
    protein/RNA complex; complexed with edo, gol, lys

Details for d5elna2

PDB Entry: 5eln (more details), 1.9 Å

PDB Description: crystal structure of lysyl-trna synthetase from cryptosporidium parvum complexed with l-lysine
PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d5elna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5elna2 d.104.1.0 (A:194-545) automated matches {Cryptosporidium parvum [TaxId: 353152]}
dqevryrqryldlmlneesrkvfklrsraikyirnyfdrlgflevetpmlnmiyggaaar
pfityhneletqlymriapelylkqlivggldkvyeigknfrnegidlthnpeftamefy
mayadyydlmdlteelisglvleihgslkipyhpdgpegkcieidfttpwkrfsfveeie
sglgeklkrpldsqenidfmvemcekheielphprtaaklldklaghfvetkctnpsfii
dhpqtmsplakwhrekpemterfelfvlgkelcnaytelneplqqrkffeqqadakasgd
veacpidetfclalehglpptggwglgidrlimfladknnikevilfpamrn

SCOPe Domain Coordinates for d5elna2:

Click to download the PDB-style file with coordinates for d5elna2.
(The format of our PDB-style files is described here.)

Timeline for d5elna2: