Lineage for d5ekza_ (5ekz A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3020249Fold e.39: YebC-like [75624] (1 superfamily)
    3 domains: (1) 3-helical bundle; (2 and 3 ) alpha+beta of different folds: domain 3 has a ferredoxin-like fold and is inserted in domain 2
  4. 3020250Superfamily e.39.1: YebC-like [75625] (2 families) (S)
    automatically mapped to Pfam PF01709
  5. 3020264Family e.39.1.0: automated matches [318992] (1 protein)
    not a true family
  6. 3020265Protein automated matches [318993] (1 species)
    not a true protein
  7. 3020266Species Mouse (Mus musculus) [TaxId:10090] [318994] (1 PDB entry)
  8. 3020267Domain d5ekza_: 5ekz A: [318995]
    automated match to d1lfpa_

Details for d5ekza_

PDB Entry: 5ekz (more details), 2 Å

PDB Description: crystal structure of mouse taco1
PDB Compounds: (A:) Translational activator of cytochrome c oxidase 1

SCOPe Domain Sequences for d5ekza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ekza_ e.39.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rsrifskltlsirlavkeggpnpennsslanilelcrsknmpkstiesalkteknkgiyl
lyegrgpggsslliealsnsgpkchldikyilnknggmmaegarhffdkkgvvvvgvedr
ekkavnleralelaieagaedvkeaedeeeknlfkficdasslhqvrkkldslglcpvsc
smefiphskvqlaepeleqaahliqalnnyedvihvydnie

SCOPe Domain Coordinates for d5ekza_:

Click to download the PDB-style file with coordinates for d5ekza_.
(The format of our PDB-style files is described here.)

Timeline for d5ekza_: