Lineage for d5eb1b_ (5eb1 B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.7: OmpA-like [103088] (2 families) 
Family d.79.7.0: automated matches [195454] (1 protein)
not a true familyProtein automated matches [195455] (14 species)
not a true protein
Species Pseudomonas aeruginosa [TaxId:208964] [316357] (11 PDB entries) 
Domain d5eb1b_: 5eb1 B: [317435]
automated match to d4zhva_
complexed with so4
Details for d5eb1b_
PDB Entry: 5eb1 (more details), 1.8 Å
PDB Description: the yfib-yfir complex
PDB Compounds: (B:) YfiBSCOPe Domain Sequences for d5eb1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eb1b_ d.79.7.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
qeqgfelrdegwefgmsskvlfgnnldrlnpdsrntltkiarallavdidkvrleghtdn
ygdegynqklserraesvaavfreagmpaanievrglgmskpvadnktragrsenrrvai
ivpa
SCOPe Domain Coordinates for d5eb1b_:
Click to download the PDB-style file with coordinates for d5eb1b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5eb1b_:
- d5eb1b_ first appeared in SCOPe 2.06
- d5eb1b_ appears in SCOPe 2.07
View in 3D
