Lineage for d5e7ua_ (5e7u A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2522032Protein automated matches [190140] (38 species)
    not a true protein
  7. 2522109Species Escherichia coli [TaxId:562] [189978] (3 PDB entries)
  8. 2522116Domain d5e7ua_: 5e7u A: [313808]
    automated match to d3q28a_
    complexed with mal, so4

Details for d5e7ua_

PDB Entry: 5e7u (more details), 2.8 Å

PDB Description: mbp-mamc loop structure, a magnetite biomineralizing protein from magnetospirillium magneticum amb-1
PDB Compounds: (A:) Maltose-binding periplasmic protein,Tightly bound bacterial magnetic particle protein,Maltose-binding periplasmic protein

SCOPe Domain Sequences for d5e7ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e7ua_ c.94.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdlkekritnteaaidtgk

SCOPe Domain Coordinates for d5e7ua_:

Click to download the PDB-style file with coordinates for d5e7ua_.
(The format of our PDB-style files is described here.)

Timeline for d5e7ua_: