Lineage for d5e0sb_ (5e0s B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854016Species Mycobacterium tuberculosis [TaxId:83331] [315286] (2 PDB entries)
  8. 2854031Domain d5e0sb_: 5e0s B: [315629]
    automated match to d1y7oc_

Details for d5e0sb_

PDB Entry: 5e0s (more details), 2.9 Å

PDB Description: crystal structure of the active form of the proteolytic complex clpp1 and clpp2
PDB Compounds: (B:) ATP-dependent Clp protease proteolytic subunit 2

SCOPe Domain Sequences for d5e0sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e0sb_ c.14.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
yilpsfiehssfgvkesnpynklfeeriiflgvqvddasandimaqllvlesldpdrdit
myinspgggftslmaiydtmqyvradiqtvclgqaasaaavllaagtpgkrmalpnarvl
ihqpslsgviqgqfsdleiqaaeiermrtlmettlarhtgkdagvirkdtdrdkiltaee
akdygiidtvleyrklsaqta

SCOPe Domain Coordinates for d5e0sb_:

Click to download the PDB-style file with coordinates for d5e0sb_.
(The format of our PDB-style files is described here.)

Timeline for d5e0sb_: