Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (42 species) not a true protein |
Species Brucella ovis [TaxId:444178] [278686] (2 PDB entries) |
Domain d5dwnd_: 5dwn D: [278690] Other proteins in same PDB: d5dwna2, d5dwnb2 automated match to d2j8ma_ complexed with aco, cl, mg |
PDB Entry: 5dwn (more details), 1.95 Å
SCOPe Domain Sequences for d5dwnd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dwnd_ d.108.1.0 (D:) automated matches {Brucella ovis [TaxId: 444178]} mpvirdfqpadietitaiytqavltgtgsyeiepptmdemakrfaafadqgfpilvaead grvlgyayasyfrvrpayrwlaedsiyiapdakgqgigklllreliarisalgfrqllav igdgehnigsvklheslgfthcgriegsgfkhgrwldtvlmqlplnggrstepgpspls
Timeline for d5dwnd_: