Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.56: CcmK-like [143414] (2 families) contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
Family d.58.56.0: automated matches [195116] (1 protein) not a true family |
Protein automated matches [195117] (13 species) not a true protein |
Species Haliangium ochraceum [TaxId:502025] [279894] (3 PDB entries) |
Domain d5dihd1: 5dih D:18-114 [345585] automated match to d3nwga1 |
PDB Entry: 5dih (more details), 2.44 Å
SCOPe Domain Sequences for d5dihd1:
Sequence, based on SEQRES records: (download)
>d5dihd1 d.58.56.0 (D:18-114) automated matches {Haliangium ochraceum [TaxId: 502025]} drpalgvleltsiargitvadaalkrapslllmsrpvssgkhllmmrgqvaeveesmiaa reiagagsgalldelelpyaheqlwrfldapvvadaw
>d5dihd1 d.58.56.0 (D:18-114) automated matches {Haliangium ochraceum [TaxId: 502025]} drpalgvleltsiargitvadaalkrapslllmsrpvssgkhllmmrgqvaeveesmiaa reiagagalldelelpyaheqlwrfldapvvadaw
Timeline for d5dihd1:
View in 3D Domains from other chains: (mouse over for more information) d5diha1, d5diha2, d5dihf1, d5dihf2 |