Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Francisella tularensis [TaxId:393115] [276956] (1 PDB entry) |
Domain d5dgxa_: 5dgx A: [276957] automated match to d2ixfd_ complexed with adp |
PDB Entry: 5dgx (more details), 1.73 Å
SCOPe Domain Sequences for d5dgxa_:
Sequence, based on SEQRES records: (download)
>d5dgxa_ c.37.1.0 (A:) automated matches {Francisella tularensis [TaxId: 393115]} ketgskelakvdgnvtikdlsfafgehkvlsgvsvdikagqtvafvgksgsgkttltsii srfytqhegeilldgvdtreltlenlrshlsivsqnvhlfddtvynniafglsrevseee vidalkranayefvqelsdgintnignngsklsggqrqrisiarallknapvlifdeats aldneservvqqalesltkscttiviahrlstvenadkivvmdggrvvesgkhqelleqg glytrlyqsglq
>d5dgxa_ c.37.1.0 (A:) automated matches {Francisella tularensis [TaxId: 393115]} ketgskelakvdgnvtikdlsfafgehkvlsgvsvdikagqtvafvgksgsgkttltsii srfytqhegeilldgvdtreltlenlrshlsivsqnvhlfddtvynniafgevseeevid alkranayefvqelsdgintnignngsklsggqrqrisiarallknapvlifdelesltk scttiviahrlstvenadkivvmdggrvvesgkhqelleqgglytrlyqsglq
Timeline for d5dgxa_: