Lineage for d5ddta_ (5ddt A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the restSuperfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) 
Family c.68.1.0: automated matches [191551] (1 protein)
not a true familyProtein automated matches [190951] (34 species)
not a true protein
Species Bacillus subtilis [TaxId:224308] [321878] (3 PDB entries) 
Domain d5ddta_: 5ddt A: [321879]
automated match to d4naka_
Details for d5ddta_
PDB Entry: 5ddt (more details), 1.8 Å
PDB Description: crystal structure of ispd from bacillus subtilis at 1.80 angstroms resolution, crystal form i
PDB Compounds: (A:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferaseSCOPe Domain Sequences for d5ddta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ddta_ c.68.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
msydvvipaagqgkrmkagrnklfielkgdpviihtlrvfdshrqcdkiilvineqereh
fqqllsdypfqtsielvaggderqhsvykglkavkqekivlvhdgarpfikheqidelia
eaeqtgaailavpvkdtikrvqdlqvsetiersslwavqtpqafrlsllmkahaeaerkg
flgtddaslveqmeggsvrvvegsytniklttpddltsaeaimesesgnkhv
SCOPe Domain Coordinates for d5ddta_:
Click to download the PDB-style file with coordinates for d5ddta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5ddta_:
- d5ddta_ first appeared in SCOPe 2.06
- d5ddta_ appears in SCOPe 2.07
View in 3D
