Lineage for d5daya1 (5day A:19-224)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.305: NAP-like [143112] (1 superfamily)
    core: central meander 4-stranded beta-sheet (order: 1234) transversed by a C-terminal helix
  4. Superfamily d.305.1: NAP-like [143113] (2 families) (S)
  5. Family d.305.1.0: automated matches [196445] (1 protein)
    not a true family
  6. Protein automated matches [196446] (6 species)
    not a true protein
  7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [322879] (2 PDB entries)
  8. Domain d5daya1: 5day A:19-224 [322880]
    Other proteins in same PDB: d5daya2, d5dayb2
    automated match to d2e50b_
    complexed with ca

Details for d5daya1

PDB Entry: 5day (more details), 2.3299999999999996 Å

PDB Description: the structure of nap1-related protein(nrp1) in arabidopsis
PDB Compounds: (A:) NAP1-related protein 1

SCOPe Domain Sequences for d5daya1:

Sequence, based on SEQRES records: (download)

>d5daya1 d.305.1.0 (A:19-224) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nleqidaelvlsieklqeiqddlekinekasdevleveqkynvirkpvydkrneviqsip
gfwmtaflshpalgdllteedqkifkylnslevedakdvksgysitfhftsnpffedakl
tktftfleegttkitatpikwkegkglpngvnhddkkgnkralpeesfftwftdaqhked
agdeihdevadiikedlwsnpltyfn

Sequence, based on observed residues (ATOM records): (download)

>d5daya1 d.305.1.0 (A:19-224) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
nleqidaelvlsieklqeiqddlekinekasdevleveqkynvirkpvydkrneviqsip
gfwmtaflshpalgdllteedqkifkylnslevedakdvksgysitfhftsnpffedakl
tktftflegttkitatpikwkegsfftwfthdevadiikedlwsnpltyfn

SCOPe Domain Coordinates for d5daya1 are not available.

Timeline for d5daya1:

Domains from same chain:
(mouse over for more information)
d5daya2
Domains from other chains:
(mouse over for more information)
d5dayb1, d5dayb2