Lineage for d5d9na_ (5d9n A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441652Species Prevotella bryantii [TaxId:77095] [276992] (6 PDB entries)
  8. 2441661Domain d5d9na_: 5d9n A: [278950]
    automated match to d4im4a_
    complexed with bgc, ca, xys

Details for d5d9na_

PDB Entry: 5d9n (more details), 1.86 Å

PDB Description: crystal structure of pbgh5a, a glycoside hydrolase family 5 member from prevotella bryantii b14, in complex with the xyloglucan heptasaccharide xxxg
PDB Compounds: (A:) B-1,4-endoglucanase

SCOPe Domain Sequences for d5d9na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d9na_ c.1.8.0 (A:) automated matches {Prevotella bryantii [TaxId: 77095]}
natymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtflmqn
gfnavripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsgawik
adtdvyaatkekfkklwtqianaladydqhllfegynemldgnnswdepqkasgyealnn
yaqdfvdavratggnnatrnlivntyaaakgenvlnnfmlptdavnnhlivqvhsydpwn
ffntkttwdsechntlteifsalskkfttipyiigeygthgesdisvsksspaekiklaa
dqaadmvklakdhhsatfywmsifdgsdriqpqwslptvveamqeaynn

SCOPe Domain Coordinates for d5d9na_:

Click to download the PDB-style file with coordinates for d5d9na_.
(The format of our PDB-style files is described here.)

Timeline for d5d9na_: