Lineage for d5d7rb_ (5d7r B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
8-stranded mixed beta-sheet; 2 layers: alpha/betaSuperfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) 
Family d.122.1.0: automated matches [227160] (1 protein)
not a true familyProtein automated matches [226867] (22 species)
not a true protein
Species Staphylococcus aureus [TaxId:1280] [232247] (22 PDB entries) 
Domain d5d7rb_: 5d7r B: [279441]
automated match to d3u2ka_
protein/DNA complex; complexed with 57y, cl, mg, mpd
Details for d5d7rb_
PDB Entry: 5d7r (more details), 1.55 Å
PDB Description: crystal structure of the atp binding domain of s. aureus gyrb complexed with a ligand
PDB Compounds: (B:) DNA gyrase subunit bSCOPe Domain Sequences for d5d7rb_:
Sequence, based on SEQRES records: (download)
>d5d7rb_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
iqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwik
vtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfd
lkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeen
vredsyhyeg
Sequence, based on observed residues (ATOM records): (download)
>d5d7rb_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
iqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwik
vtdngrgipvdiqgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlke
vgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvre
dsyhyeg
SCOPe Domain Coordinates for d5d7rb_:
Click to download the PDB-style file with coordinates for d5d7rb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5d7rb_:
- d5d7rb_ first appeared in SCOPe 2.05
- d5d7rb_ appears in SCOPe 2.07
View in 3D
