Lineage for d5cksb_ (5cks B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444150Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)
  6. 2444349Protein automated matches [190083] (10 species)
    not a true protein
  7. 2444378Species Escherichia coli [TaxId:83333] [320941] (1 PDB entry)
  8. 2444380Domain d5cksb_: 5cks B: [320944]
    automated match to d1og0h_
    complexed with 52l, gal

Details for d5cksb_

PDB Entry: 5cks (more details), 2.12 Å

PDB Description: dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase in complex with dahp oxime.
PDB Compounds: (B:) Phospho-2-dehydro-3-deoxyheptonate aldolase, Phe-sensitive

SCOPe Domain Sequences for d5cksb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cksb_ c.1.10.4 (B:) automated matches {Escherichia coli [TaxId: 83333]}
ddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihd
pvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglri
arkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgf
kngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakh
vaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshl
vegnqslesgeplaygksitdacigwedtdallrqlanavkarrg

SCOPe Domain Coordinates for d5cksb_:

Click to download the PDB-style file with coordinates for d5cksb_.
(The format of our PDB-style files is described here.)

Timeline for d5cksb_: