Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) |
Family c.8.5.0: automated matches [227259] (1 protein) not a true family |
Protein automated matches [227050] (2 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [319461] (2 PDB entries) |
Domain d5cdja_: 5cdj A: [319501] automated match to d3vz7a_ |
PDB Entry: 5cdj (more details), 1.75 Å
SCOPe Domain Sequences for d5cdja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cdja_ c.8.5.0 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} gmeidrgyispqfvtnqerllveydncrvlvtdqkidairdiipileqvtrlnaplliia edvsgealatlvvnklrgvlnvcaikapgfgerrksllqdiaivtgaefiakdlgmkveq avveqlgvarkvtvanntttliadaaskdeiemriaqlkkelaetdsvydteklseriak ls
Timeline for d5cdja_: