Lineage for d5c8ga_ (5c8g A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topologySuperfamily a.29.2: Bromodomain [47370] (2 families) 
Family a.29.2.0: automated matches [191428] (1 protein)
not a true familyProtein automated matches [190615] (15 species)
not a true protein
Species Trypanosoma brucei [TaxId:679716] [275175] (2 PDB entries) 
Domain d5c8ga_: 5c8g A: [275177]
automated match to d4a9ib_
complexed with r78, unx
Details for d5c8ga_
PDB Entry: 5c8g (more details), 1.95 Å
PDB Description: crystal structure analysis of pp-brd20 from tb427tmp complexed with bi-2536
PDB Compounds: (A:) pp-brd20SCOPe Domain Sequences for d5c8ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c8ga_ a.29.2.0 (A:) automated matches {Trypanosoma brucei [TaxId: 679716]}
lpknkhvfhsdqrlapeirdlydclyklyaeesaseyfrepvdalrvgawnyysvitepm
slrtvldyivqggryshveqimndveliwknceryngaeshlaadarrcrailekhrerl
ad
SCOPe Domain Coordinates for d5c8ga_:
Click to download the PDB-style file with coordinates for d5c8ga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5c8ga_:
- d5c8ga_ first appeared in SCOPe 2.05
- d5c8ga_ appears in SCOPe 2.07
View in 3D
