Class b: All beta proteins [48724] (177 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins) the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2 there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus) |
Protein automated matches [190854] (15 species) not a true protein |
Species Coxsackievirus a16 [TaxId:31704] [276274] (3 PDB entries) |
Domain d5c4wc_: 5c4w C: [276275] Other proteins in same PDB: d5c4wa_, d5c4wb_ automated match to d3vbhc_ complexed with cl, k, na, sph |
PDB Entry: 5c4w (more details), 2.65 Å
SCOPe Domain Sequences for d5c4wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c4wc_ b.121.4.1 (C:) automated matches {Coxsackievirus a16 [TaxId: 31704]} giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisnthyrah aragyfdyyttgiitiwyqtnyvvpigapttayivalaaaqdnftmklckdtedieqtan iq
Timeline for d5c4wc_: