Lineage for d5brka_ (5brk A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708838Superfamily a.29.7: Mob1/phocein [101152] (2 families) (S)
    common fold is elaborated with additional short helices; contains a zinc-binding site
    automatically mapped to Pfam PF03637
  5. 2708839Family a.29.7.1: Mob1/phocein [101153] (2 proteins)
  6. 2708845Protein automated matches [319235] (2 species)
    not a true protein
  7. 2708846Species Human (Homo sapiens) [TaxId:9606] [333010] (7 PDB entries)
  8. 2708849Domain d5brka_: 5brk A: [345562]
    automated match to d5twfa_
    complexed with zn

Details for d5brka_

PDB Entry: 5brk (more details), 2.3 Å

PDB Description: pmob1-lats1 complex
PDB Compounds: (A:) MOB kinase activator 1A

SCOPe Domain Sequences for d5brka_:

Sequence, based on SEQRES records: (download)

>d5brka_ a.29.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sktfkpkknipegshqyellkhaeatlgsgnlrqavmlpegedlnewiavntvdffnqin
mlygtitefcteascpvmsagpryeyhwadgtnikkpikcsapkyidylmtwvqdqldde
tlfpskigvpfpknfmsvaktilkrlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiff
vqefnlidrrelaplqelieklg

Sequence, based on observed residues (ATOM records): (download)

>d5brka_ a.29.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sktfkpkknipeellkhaeatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygt
itefcteascpvmsagpryeyhwadgtpikcsapkyidylmtwvqdqlddetlfpskigv
pfpknfmsvaktilkrlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidr
relaplqelieklg

SCOPe Domain Coordinates for d5brka_:

Click to download the PDB-style file with coordinates for d5brka_.
(The format of our PDB-style files is described here.)

Timeline for d5brka_: