Lineage for d5bqdb_ (5bqd B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. Family b.2.5.4: T-box [81316] (3 proteins)
    automatically mapped to Pfam PF00907
  6. Protein automated matches [191154] (1 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [189324] (4 PDB entries)
  8. Domain d5bqdb_: 5bqd B: [312676]
    automated match to d2x6va_
    complexed with mg

Details for d5bqdb_

PDB Entry: 5bqd (more details), 2.58 Å

PDB Description: crystal structure of tbx5 (1-239) dimer
PDB Compounds: (B:) t-box transcription factor tbx5

SCOPe Domain Sequences for d5bqdb_:

Sequence, based on SEQRES records: (download)

>d5bqdb_ b.2.5.4 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ftqqgmegikvflherelwlkfhevgtemiitkagrrmfpsykvkvtglnpktkyillmd
ivpaddhrykfadnkwsvtgkaepampgrlyvhpdspatgahwmrqlvsfqklkltnnhl
dpfghiilnsmhkyqprlhivkadenngfgskntafcthvfpetafiavtsyqnhkitql
kienn

Sequence, based on observed residues (ATOM records): (download)

>d5bqdb_ b.2.5.4 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ftqqgmegikvflherelwlkfhevgtemiitkagrrmfpsykvkvtglnpktkyillmd
ivpaddhrykfadnkwsvtgkaepampgrlyvhpdspatgahwmrqlvsfqklkltnnhl
dpfghiilnsmhkyqprlhivkantafcthvfpetafiavtsyqnhkitqlkienn

SCOPe Domain Coordinates for d5bqdb_ are not available.

Timeline for d5bqdb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5bqda_