Lineage for d5bqcb_ (5bqc B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734685Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily)
    Core: 3 helices; irregular array; disulfide-rich
  4. 2734686Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families) (S)
    automatically mapped to Pfam PF01392
  5. 2734716Family a.141.1.0: automated matches [274414] (1 protein)
    not a true family
  6. 2734717Protein automated matches [274417] (1 species)
    not a true protein
  7. 2734718Species Human (Homo sapiens) [TaxId:9606] [274420] (11 PDB entries)
  8. 2734740Domain d5bqcb_: 5bqc B: [274429]
    automated match to d1ijya_
    complexed with nag

Details for d5bqcb_

PDB Entry: 5bqc (more details), 3 Å

PDB Description: crystal structure of norrin in complex with the cysteine-rich domain of frizzled 4 and sucrose octasulfate
PDB Compounds: (B:) Frizzled-4

SCOPe Domain Sequences for d5bqcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bqcb_ a.141.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvy
vpmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcmegp
gdee

SCOPe Domain Coordinates for d5bqcb_:

Click to download the PDB-style file with coordinates for d5bqcb_.
(The format of our PDB-style files is described here.)

Timeline for d5bqcb_: