![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein automated matches [193445] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [193446] (79 PDB entries) |
![]() | Domain d5b2jd_: 5b2j D: [318484] Other proteins in same PDB: d5b2ja_, d5b2jb_, d5b2je_, d5b2jf_ automated match to d1kx4d_ protein/DNA complex; complexed with mn |
PDB Entry: 5b2j (more details), 2.6 Å
SCOPe Domain Sequences for d5b2jd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b2jd_ a.22.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rkrsrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrst itsreiqtavrlllpgelakhavsegtkavtkytsak
Timeline for d5b2jd_: