Lineage for d5b2da_ (5b2d A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. Protein automated matches [193245] (21 species)
    not a true protein
  7. Species Mumps virus [TaxId:11161] [323195] (2 PDB entries)
  8. Domain d5b2da_: 5b2d A: [323283]
    automated match to d1e8ub_
    complexed with nag, so4

Details for d5b2da_

PDB Entry: 5b2d (more details), 2.18 Å

PDB Description: crystal structure of mumps virus hemagglutinin-neuraminidase bound to 3-sialyllactose
PDB Compounds: (A:) HN protein

SCOPe Domain Sequences for d5b2da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b2da_ b.68.1.1 (A:) automated matches {Mumps virus [TaxId: 11161]}
plvndlrfinginkfiiedyathdfsighplnmpsfiptatspngctripsfslgkthwc
ythnvinanckdhtssnqyismgilvqtasgypmfktlkiqylsdglnrkscsiatvpdg
camycyvstqletddyagsspptqkltllfyndtvtertisptglegnwatlvpgvgsgi
yfenklifpayggvlpnstlgvksareffrpvnpynpcsgpqqdldqralrsyfpsyfsn
rrvqsaflvcawnqilvtncelvvpsnnqtlmgaegrvllinnrllyyqrstswwpyell
yeisftftnsgqssvnmswipiysftrpgsgncsgenvcptacvsgvyldpwpltpyshq
sginrnfyftgallnssttrvnptlyvsalnnlkvlapygnqglfasyttttcfqdtgda
svycvyimelasnivgefqilpvltrltit

SCOPe Domain Coordinates for d5b2da_ are not available.

Timeline for d5b2da_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5b2db_