Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein Apoptosis regulator Bcl-xL [56856] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [56857] (46 PDB entries) |
Domain d5b1za_: 5b1z A: [327550] automated match to d4z9vb_ |
PDB Entry: 5b1z (more details), 2.15 Å
SCOPe Domain Sequences for d5b1za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b1za_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]} msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd hlepwiqenggwdtfvelygnnaa
Timeline for d5b1za_: