Lineage for d5b1za_ (5b1z A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2626588Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2626682Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2626683Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 2626689Protein Apoptosis regulator Bcl-xL [56856] (3 species)
  7. 2626690Species Human (Homo sapiens) [TaxId:9606] [56857] (46 PDB entries)
  8. 2626751Domain d5b1za_: 5b1z A: [327550]
    automated match to d4z9vb_

Details for d5b1za_

PDB Entry: 5b1z (more details), 2.15 Å

PDB Description: crystal structure of bcl-xl in complex with hbx-bh3 motif
PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d5b1za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1za_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelygnnaa

SCOPe Domain Coordinates for d5b1za_:

Click to download the PDB-style file with coordinates for d5b1za_.
(The format of our PDB-style files is described here.)

Timeline for d5b1za_:

2626751
d5b1za_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d5b1zb_