Lineage for d5azpa_ (5azp A:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.5: Outer membrane efflux proteins (OEP) [56953] (1 superfamily)
    subunit fold contains tandem repeat of alpha-beta hairpin-alpha(2) motif
    trimeric fold contains barrel (n=12, S=18) formed by beta-hairpins, two from each subunit, and a bundle of helices with a channel running through it
  4. Superfamily f.5.1: Outer membrane efflux proteins (OEP) [56954] (2 families) (S)
  5. Family f.5.1.0: automated matches [227266] (1 protein)
    not a true family
  6. Protein automated matches [227059] (5 species)
    not a true protein
  7. Species Pseudomonas aeruginosa [TaxId:208964] [318062] (5 PDB entries)
  8. Domain d5azpa_: 5azp A: [318133]
    Other proteins in same PDB: d5azpb2
    automated match to d1wp1b_
    complexed with 3pk, act, bog, fmt, gol, na, oya

Details for d5azpa_

PDB Entry: 5azp (more details), 1.6900000000000002 Å

PDB Description: crystal structure of a membrane protein from pseudomonas aeruginosa
PDB Compounds: (A:) Multidrug efflux outer membrane protein OprN

SCOPe Domain Sequences for d5azpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5azpa_ f.5.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
ctvgpdyrtpdtaaakidataskpydrsrfeslwwkqfddptlnqlveqslsgnrdlrva
farlraaralrddvandrfpvvtsrasadigkgqqpgvtedrvnserydlgldsaweldl
fgrirrqlessdalseaaeadlqqlqvsliaelvdaygqlrgaqlrekialsnlenqkes
rqlteqlrdagvgaeldvlradarlaataasvpqlqaeaerarhriatllgqrpeeltvd
lsprdlpaitkalpigdpgellrrrpdiraaerrlaastadvgvatadlfprvslsgflg
ftagrgsqigssaarawsvgpsiswaafdlgsvrarlrgakadadaalasyeqqvllale
esanafsdygkrqerlvslvrqseasraaaqqaairyregttdflvlldaereqlsaeda
qaqaevelyrgivaiyrslgggwqps

SCOPe Domain Coordinates for d5azpa_ are not available.

Timeline for d5azpa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5azpb1, d5azpb2, d5azpc_