Lineage for d5azha_ (5azh A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540612Species Nematode (Caenorhabditis elegans) [TaxId:6239] [255480] (4 PDB entries)
  8. 2540615Domain d5azha_: 5azh A: [280114]
    automated match to d3wanb_
    complexed with mg

Details for d5azha_

PDB Entry: 5azh (more details), 2.3 Å

PDB Description: crystal structure of lgg-2 fused with an eeeweel peptide
PDB Compounds: (A:) EEEWEEL peptide,Protein lgg-2

SCOPe Domain Sequences for d5azha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5azha_ d.15.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
eeweelgsgivpsfkerrpfherqkdveeirsqqpnkvpviierfdgerslplmdrckfl
vpehitvaelmsivrrrlqlhpqqaffllvnersmvsnsmsmsnlysqerdpdgfvymvy
tsqpafg

SCOPe Domain Coordinates for d5azha_:

Click to download the PDB-style file with coordinates for d5azha_.
(The format of our PDB-style files is described here.)

Timeline for d5azha_: