Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [255480] (4 PDB entries) |
Domain d5azha_: 5azh A: [280114] automated match to d3wanb_ complexed with mg |
PDB Entry: 5azh (more details), 2.3 Å
SCOPe Domain Sequences for d5azha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5azha_ d.15.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} eeweelgsgivpsfkerrpfherqkdveeirsqqpnkvpviierfdgerslplmdrckfl vpehitvaelmsivrrrlqlhpqqaffllvnersmvsnsmsmsnlysqerdpdgfvymvy tsqpafg
Timeline for d5azha_: