Lineage for d5aa7a_ (5aa7 A:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.18: E set domains [81296] (24 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamiliesFamily b.1.18.0: automated matches [191341] (1 protein)
not a true familyProtein automated matches [190226] (55 species)
not a true protein
Species Jonesia denitrificans [TaxId:43674] [279770] (1 PDB entry) 
Domain d5aa7a_: 5aa7 A: [279772]
automated match to d4a02a_
complexed with cu1
Details for d5aa7a_
PDB Entry: 5aa7 (more details), 1.55 Å
PDB Description: structural and functional characterization of a chitin-active 15.5 kda lytic polysaccharide monooxygenase domain from a modular chitinase from jonesia denitrificans
PDB Compounds: (A:) chitinaseSCOPe Domain Sequences for d5aa7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aa7a_ b.1.18.0 (A:) automated matches {Jonesia denitrificans [TaxId: 43674]}
hgwvtdppsrqalcasgetsfdcgqisyepqsveapkgattcsggneafailddnskpwp
tteiastvdltwkltaphntstweyfvdgqlhqtfdqkgqqpptslthtltdlptgehti
larwnvsntnnafyncmdvvvs
SCOPe Domain Coordinates for d5aa7a_:
Click to download the PDB-style file with coordinates for d5aa7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5aa7a_:
- d5aa7a_ first appeared in SCOPe 2.05
- d5aa7a_ appears in SCOPe 2.07
- d5aa7a_ appears in the current release, SCOPe 2.08
View in 3D
