Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) |
Family d.118.1.0: automated matches [191348] (1 protein) not a true family |
Protein automated matches [190280] (9 species) not a true protein |
Species Branchiostoma belcheri [TaxId:155462] [278267] (1 PDB entry) |
Domain d4zxma_: 4zxm A: [278268] automated match to d1s2jb_ |
PDB Entry: 4zxm (more details), 2.8 Å
SCOPe Domain Sequences for d4zxma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zxma_ d.118.1.0 (A:) automated matches {Branchiostoma belcheri [TaxId: 155462]} tcprivsksewgsratnynvflslpvpkvvihhsagatcstqsscslqvrniqnyhmdgr gysdigynflvgndgnvyegrgwdrrgahalnvntesigicfmgdftsqkptasaiaaak sliscgvslgkirsgyslyghrdvgstacpgnllyddikswgryv
Timeline for d4zxma_: