Lineage for d4zxma_ (4zxm A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972806Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2972807Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2973039Family d.118.1.0: automated matches [191348] (1 protein)
    not a true family
  6. 2973040Protein automated matches [190280] (10 species)
    not a true protein
  7. 2973051Species Branchiostoma belcheri [TaxId:155462] [278267] (1 PDB entry)
  8. 2973052Domain d4zxma_: 4zxm A: [278268]
    automated match to d1s2jb_

Details for d4zxma_

PDB Entry: 4zxm (more details), 2.8 Å

PDB Description: crystal structure of pgrp domain from branchiostoma belcheri tsingtauense peptidoglycan recognition protein 3
PDB Compounds: (A:) PGRP domain of peptidoglycan recognition protein 3

SCOPe Domain Sequences for d4zxma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zxma_ d.118.1.0 (A:) automated matches {Branchiostoma belcheri [TaxId: 155462]}
tcprivsksewgsratnynvflslpvpkvvihhsagatcstqsscslqvrniqnyhmdgr
gysdigynflvgndgnvyegrgwdrrgahalnvntesigicfmgdftsqkptasaiaaak
sliscgvslgkirsgyslyghrdvgstacpgnllyddikswgryv

SCOPe Domain Coordinates for d4zxma_:

Click to download the PDB-style file with coordinates for d4zxma_.
(The format of our PDB-style files is described here.)

Timeline for d4zxma_: