Lineage for d4zxfc_ (4zxf C:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. Protein automated matches [190543] (128 species)
    not a true protein
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [316344] (2 PDB entries)
  8. Domain d4zxfc_: 4zxf C: [317866]
    automated match to d3hjua_
    complexed with 4s7, no3, so4

Details for d4zxfc_

PDB Entry: 4zxf (more details), 2.5 Å

PDB Description: crystal structure of a soluble variant of monoglyceride lipase from saccharomyces cerevisiae in complex with a substrate analog
PDB Compounds: (C:) Monoglyceride lipase

SCOPe Domain Sequences for d4zxfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zxfc_ c.69.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mapypykvqttvpelqyenfdgakfgymfwpvqngtnevrgrvllihgfgeytkiqfrlm
dhlslngyesftfdqrgagvtspgrskgvtdeyhvfndlehfveknlseckakgiplfmw
ghsmgggiclnyacqgkhkneisgyigsgpliilhphtmynkptqiiapllakfsprvri
dtgldlkgitsdkayraflgsdpmsvplygsfrqihdfmqrgaklyknennyiqknfakd
kpviimhgqddtindpkgsekfirdcpsadkelklypgarhsifsletdkvfntvfndmk
qwldkht

SCOPe Domain Coordinates for d4zxfc_ are not available.

Timeline for d4zxfc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4zxfa_, d4zxfb_, d4zxfd_