Lineage for d4zhva_ (4zhv A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. Family d.79.7.0: automated matches [195454] (1 protein)
    not a true family
  6. Protein automated matches [195455] (14 species)
    not a true protein
  7. Species Pseudomonas aeruginosa [TaxId:208964] [316357] (11 PDB entries)
  8. Domain d4zhva_: 4zhv A: [316386]
    automated match to d4r40b_
    complexed with so4

Details for d4zhva_

PDB Entry: 4zhv (more details), 1.59 Å

PDB Description: crystal structure of a bacterial signalling protein
PDB Compounds: (A:) YfiB

SCOPe Domain Sequences for d4zhva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zhva_ d.79.7.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
ppqtglsaeqiavlqeqgfelrdegwefgmsskvlfgnnldrlnpdsrntltkiaralla
vdidkvrleghtdnygdegynqklserraesvaavfreagmpaanievrglgmskpvadn
ktragrsenrrvaiivpae

SCOPe Domain Coordinates for d4zhva_ are not available.

Timeline for d4zhva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4zhvb_