Lineage for d4z07c1 (4z07 C:94-227)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2082002Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2082241Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2082242Protein automated matches [226927] (14 species)
    not a true protein
  7. 2082262Species Human (Homo sapiens) [TaxId:9606] [256346] (13 PDB entries)
  8. 2082285Domain d4z07c1: 4z07 C:94-227 [315523]
    automated match to d3of1a1
    complexed with ipa, pcg, so4

Details for d4z07c1

PDB Entry: 4z07 (more details), 2.5 Å

PDB Description: co-crystal structure of the tandem cnb (cnb-a/b) domains of human pkg i beta with cgmp
PDB Compounds: (C:) cGMP-dependent protein kinase 1

SCOPe Domain Sequences for d4z07c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z07c1 b.82.3.0 (C:94-227) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vtlpfypkspqskdlikeaildndfmknlelsqiqeivdcmypveygkdsciikegdvgs
lvyvmedgkvevtkegvklctmgpgkvfgelailynctrtatvktlvnvklwaidrqcfq
timmrtglikhtey

SCOPe Domain Coordinates for d4z07c1:

Click to download the PDB-style file with coordinates for d4z07c1.
(The format of our PDB-style files is described here.)

Timeline for d4z07c1:

2082285
d4z07c1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4z07c2