Lineage for d4yv7a_ (4yv7 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2161445Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2161446Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2161743Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2161744Protein automated matches [190646] (70 species)
    not a true protein
  7. 2161943Species Mycobacterium smegmatis [TaxId:246196] [232714] (3 PDB entries)
  8. 2161950Domain d4yv7a_: 4yv7 A: [271147]
    automated match to d2fn8a_
    complexed with gol

Details for d4yv7a_

PDB Entry: 4yv7 (more details), 2.3 Å

PDB Description: crystal structure of an abc transporter solute binding protein (ipr025997) from mycobacterium smegmatis (msmei_3018, target efi- 511327) with bound glycerol
PDB Compounds: (A:) Periplasmic binding protein/LacI transcriptional regulator

SCOPe Domain Sequences for d4yv7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yv7a_ c.93.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
galkigfsqatqqspfyvaltdaakaeaqaqgdelfyadangditkqnndvqdlitrgin
vlvinpvdpkgvtpslaaaeaagikvvtvdrpvesgaasfvgrdnkamgelvgkaavdtl
gpdggkiieiqgdaggavardrrdgfqaavsgrpnitivegpycdyirskavtamqdllq
ahpdlkgvyaqnddmalgamqvlaennrtdvkvfgvdglmeavraiadgdqyvatalndp
daegrlaiqtaakvargesvpefvdagtglvdksnasalvgqstfaae

SCOPe Domain Coordinates for d4yv7a_:

Click to download the PDB-style file with coordinates for d4yv7a_.
(The format of our PDB-style files is described here.)

Timeline for d4yv7a_: