Lineage for d4yrab_ (4yra B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. Protein automated matches [190069] (313 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [312116] (2 PDB entries)
  8. Domain d4yrab_: 4yra B: [312221]
    automated match to d2yy7a_

Details for d4yrab_

PDB Entry: 4yra (more details), 2.65 Å

PDB Description: mouse tdh in the apo form
PDB Compounds: (B:) L-threonine 3-dehydrogenase, mitochondrial

SCOPe Domain Sequences for d4yrab_:

Sequence, based on SEQRES records: (download)

>d4yrab_ c.2.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
epprvlitgglgqlgvglanllrkrfgkdnvilsdirkppahvfhsgpfvyanildyksl
reivvnhriswlfhysallsavgeanvslardvnitglhnvldvaaeynvrlfvpstiga
fgptsprnpapdlciqrprtiygvskvhtelmgeyyyyrygldfrclrypgiisadsqpg
ggttdyavqifhaaakngtfecnleagtrlpmmyisdclratlevmeapaerlsmrtyni
samsftpeelaqalrkhapdfqitycvdplrqaiaeswpmilddsnarkdwgwkhdfdlp
elvatmlnfhgvst

Sequence, based on observed residues (ATOM records): (download)

>d4yrab_ c.2.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
epprvlitgglgqlgvglanllrkrfgkdnvilsdirhsgpfvyanildykslreivvnh
riswlfhysardvnitglhnvldvaaeynvrlfvpstigafgptsprnpapdlciqrprt
iygvskvhtelmgeyyyyrygldfrclrypgiisadsqpgggttdyavqifhaaakngtf
ecnleagtrlpmmyisdclratlevmeapaerlsmrtynisamsftpeelaqalrkhapd
fqitycvdplrqaiaeswpmilddsnarkdwgwkhdfdlpelvatmlnfhgvst

SCOPe Domain Coordinates for d4yrab_ are not available.

Timeline for d4yrab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4yraa_, d4yrac_, d4yrad_, d4yrae_, d4yraf_, d4yrag_, d4yrah_, d4yrai_, d4yraj_, d4yrak_, d4yral_