Lineage for d4y5va_ (4y5v A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355178Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)
  8. 2355612Domain d4y5va_: 4y5v A: [272043]
    Other proteins in same PDB: d4y5vb_, d4y5vc1, d4y5vc2, d4y5ve_, d4y5vf1, d4y5vf2, d4y5vh_, d4y5vi1, d4y5vi2
    automated match to d2p49b_
    complexed with gol, peg, pge

Details for d4y5va_

PDB Entry: 4y5v (more details), 2.6 Å

PDB Description: diabody 305 complex with epor
PDB Compounds: (A:) diabody 305 VH domain

SCOPe Domain Sequences for d4y5va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y5va_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sevqlvesggglvqpggslrlscaasgftfssywmswvrqapgkglewvanikpdgseky
yvdsvkgrftisrdnaknsvylqmnslraedtavyycarvsrggsysdwgqgtlvtvssg
g

SCOPe Domain Coordinates for d4y5va_:

Click to download the PDB-style file with coordinates for d4y5va_.
(The format of our PDB-style files is described here.)

Timeline for d4y5va_: