Lineage for d4y30b_ (4y30 B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) 
Family c.66.1.0: automated matches [191451] (1 protein)
not a true familyProtein automated matches [190689] (87 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187871] (37 PDB entries) 
Domain d4y30b_: 4y30 B: [271813]
automated match to d4c03a_
complexed with 49l, gol, mg, sah
Details for d4y30b_
PDB Entry: 4y30 (more details), 2.1 Å
PDB Description: crystal structure of human protein arginine methyltransferase prmt6 bound to sah and epz020411
PDB Compounds: (B:) Protein arginine N-methyltransferase 6SCOPe Domain Sequences for d4y30b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y30b_ c.66.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgaereaalerprrtkrerdqlyyecysdvsvheemiadrvrtdayrlgilrnwaalrgk
tvldvgagtgilsifcaqagarrvyaveasaiwqqarevvrfngledrvhvlpgpvetve
lpeqvdaivsewmgygllhesmlssvlhartkwlkegglllpasaelfiapisdqmlewr
lgfwsqvkqhygvdmsclegfatrclmghseivvqglsgedvlarpqrfaqlelsragle
qelqagvggrfrcscygsapmhgfaiwfqvtfpggesekplvlstspfhpathwkqally
lnepvqveqdtdvsgeitllpsrdnprrlrvllrykvgdqeektkdfamed
SCOPe Domain Coordinates for d4y30b_:
Click to download the PDB-style file with coordinates for d4y30b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4y30b_:
- d4y30b_ first appeared in SCOPe 2.05
- d4y30b_ appears in SCOPe 2.07
View in 3D
