Lineage for d4y30b_ (4y30 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894679Species Human (Homo sapiens) [TaxId:9606] [187871] (37 PDB entries)
  8. 2894718Domain d4y30b_: 4y30 B: [271813]
    automated match to d4c03a_
    complexed with 49l, gol, mg, sah

Details for d4y30b_

PDB Entry: 4y30 (more details), 2.1 Å

PDB Description: crystal structure of human protein arginine methyltransferase prmt6 bound to sah and epz020411
PDB Compounds: (B:) Protein arginine N-methyltransferase 6

SCOPe Domain Sequences for d4y30b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y30b_ c.66.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgaereaalerprrtkrerdqlyyecysdvsvheemiadrvrtdayrlgilrnwaalrgk
tvldvgagtgilsifcaqagarrvyaveasaiwqqarevvrfngledrvhvlpgpvetve
lpeqvdaivsewmgygllhesmlssvlhartkwlkegglllpasaelfiapisdqmlewr
lgfwsqvkqhygvdmsclegfatrclmghseivvqglsgedvlarpqrfaqlelsragle
qelqagvggrfrcscygsapmhgfaiwfqvtfpggesekplvlstspfhpathwkqally
lnepvqveqdtdvsgeitllpsrdnprrlrvllrykvgdqeektkdfamed

SCOPe Domain Coordinates for d4y30b_:

Click to download the PDB-style file with coordinates for d4y30b_.
(The format of our PDB-style files is described here.)

Timeline for d4y30b_: