| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (158 species) not a true protein |
| Species Acinetobacter baumannii [TaxId:557600] [276067] (1 PDB entry) |
| Domain d4y0aa_: 4y0a A: [276068] automated match to d1viab_ complexed with skm, so4 |
PDB Entry: 4y0a (more details), 1.91 Å
SCOPe Domain Sequences for d4y0aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y0aa_ c.37.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 557600]}
pskafetlpniylvgpmgagkttvgrhlaellgrefldsdheierktgatipwifekege
vgfrtretvvlneltsrkalvlatgggaitqapnreflkqrgivvylytpvelqlqrtyr
dknrpllqvenpeqklrdllkirdplyrevahytietnqgaardlaqkilqlilsnklk
Timeline for d4y0aa_: