Lineage for d4xzpa_ (4xzp A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2052020Species Human (Homo sapiens) [TaxId:9606] [187655] (78 PDB entries)
  8. 2052050Domain d4xzpa_: 4xzp A: [311816]
    automated match to d2dyca_
    complexed with ca

Details for d4xzpa_

PDB Entry: 4xzp (more details), 1.48 Å

PDB Description: crystal structure of the n-terminal domain of human galectin-4
PDB Compounds: (A:) Galectin-4

SCOPe Domain Sequences for d4xzpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xzpa_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
papgyqptynptlpyyqpipgglnvgmsvyiqgvasehmkrffvnfvvgqdpgsdvafhf
nprfdgwdkvvfntlqggkwgseerkrsmpfkkgaafelvfivlaehykvvvngnpfyey
ghrlplqmvthlqvdgdlqlqsinfigg

SCOPe Domain Coordinates for d4xzpa_:

Click to download the PDB-style file with coordinates for d4xzpa_.
(The format of our PDB-style files is described here.)

Timeline for d4xzpa_: