Lineage for d4xx2a_ (4xx2 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007845Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 3007846Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 3007847Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins)
  6. 3007902Protein automated matches [229446] (3 species)
    not a true protein
  7. 3007911Species Xylella fastidiosa [TaxId:160492] [311803] (1 PDB entry)
  8. 3007912Domain d4xx2a_: 4xx2 A: [311804]
    automated match to d1zb9a_

Details for d4xx2a_

PDB Entry: 4xx2 (more details), 2.15 Å

PDB Description: ohr from xylella fastidiosa in oxidized state
PDB Compounds: (A:) organic hydroperoxide resistance protein

SCOPe Domain Sequences for d4xx2a_:

Sequence, based on SEQRES records: (download)

>d4xx2a_ d.227.1.1 (A:) automated matches {Xylella fastidiosa [TaxId: 160492]}
mnslekvlytaivtatggrdgsvvssdnvlnvklsvpqglggpggsgtnpeqlfaagysa
cfigalkfvankekvdlpaeprvegrvgigeipggfglvvelriavsgmersmlqtlvdk
ahrvcpysnatrgnidvvlili

Sequence, based on observed residues (ATOM records): (download)

>d4xx2a_ d.227.1.1 (A:) automated matches {Xylella fastidiosa [TaxId: 160492]}
mnslekvlytaivtatggrdgsvvssdnvlnvklsvpqglggpggsgtnpeqlfaagysa
cfigalkfvankevdlpaeprvegrvgigeipggfglvvelriavsgmersmlqtlvdka
hrvcpysnatrgnidvvlili

SCOPe Domain Coordinates for d4xx2a_:

Click to download the PDB-style file with coordinates for d4xx2a_.
(The format of our PDB-style files is described here.)

Timeline for d4xx2a_: