Lineage for d4xr8c_ (4xr8 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2767926Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2767927Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 2767928Species Human (Homo sapiens) [TaxId:9606] [49420] (65 PDB entries)
  8. 2768046Domain d4xr8c_: 4xr8 C: [311849]
    automated match to d1ycsa_
    complexed with edo, peg, zn

Details for d4xr8c_

PDB Entry: 4xr8 (more details), 2.25 Å

PDB Description: crystal structure of the hpv16 e6/e6ap/p53 ternary complex at 2.25 a resolution
PDB Compounds: (C:) Cellular tumor antigen p53

SCOPe Domain Sequences for d4xr8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xr8c_ b.2.5.2 (C:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstppp
gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfr
hsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevr
vcacpgrdrrteeenlrkk

SCOPe Domain Coordinates for d4xr8c_:

Click to download the PDB-style file with coordinates for d4xr8c_.
(The format of our PDB-style files is described here.)

Timeline for d4xr8c_: