Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) automatically mapped to Pfam PF02507 |
Family f.23.16.0: automated matches [276195] (1 protein) not a true family |
Protein automated matches [276199] (4 species) not a true protein |
Species Spinach (Spinacia oleracea) [TaxId:3562] [311473] (1 PDB entry) |
Domain d4xk8f_: 4xk8 F: [310038] Other proteins in same PDB: d4xk81_, d4xk82_, d4xk83_, d4xk84_, d4xk86_, d4xk87_, d4xk88_, d4xk89_, d4xk8a_, d4xk8b_, d4xk8c_, d4xk8d_, d4xk8e_, d4xk8j_ automated match to d4y28f_ complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 4xk8 (more details), 2.8 Å
SCOPe Domain Sequences for d4xk8f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xk8f_ f.23.16.0 (F:) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]} disgltpckeskqfakrekqalkklqaslklyaddsapalaikatmektkkrfdnygkyg llcgsdglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairdekkptqkeii idvplasrllfrgfswpvaayrellngelvd
Timeline for d4xk8f_: