Lineage for d4xk8f_ (4xk8 F:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631476Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) (S)
    automatically mapped to Pfam PF02507
  5. 2631500Family f.23.16.0: automated matches [276195] (1 protein)
    not a true family
  6. 2631501Protein automated matches [276199] (4 species)
    not a true protein
  7. 2631517Species Spinach (Spinacia oleracea) [TaxId:3562] [311473] (1 PDB entry)
  8. 2631518Domain d4xk8f_: 4xk8 F: [310038]
    Other proteins in same PDB: d4xk81_, d4xk82_, d4xk83_, d4xk84_, d4xk86_, d4xk87_, d4xk88_, d4xk89_, d4xk8a_, d4xk8b_, d4xk8c_, d4xk8d_, d4xk8e_, d4xk8j_
    automated match to d4y28f_
    complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d4xk8f_

PDB Entry: 4xk8 (more details), 2.8 Å

PDB Description: crystal structure of plant photosystem i-lhci super-complex at 2.8 angstrom resolution
PDB Compounds: (F:) photosystem I reaction center subunit III, chloroplastic

SCOPe Domain Sequences for d4xk8f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xk8f_ f.23.16.0 (F:) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]}
disgltpckeskqfakrekqalkklqaslklyaddsapalaikatmektkkrfdnygkyg
llcgsdglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairdekkptqkeii
idvplasrllfrgfswpvaayrellngelvd

SCOPe Domain Coordinates for d4xk8f_:

Click to download the PDB-style file with coordinates for d4xk8f_.
(The format of our PDB-style files is described here.)

Timeline for d4xk8f_: